Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313658925
StrainMtb_KZN_V2475
Protein IDZP_07815805.1
Description histidine kinase response regulator [Mycobacterium tuberculosis KZN
Sequence MRETLSQLRLRELLLEVQDRIEQIVEGRDRLDGLIDAILAITSGLKLDAT
LRAIVHTAAELVDARYGALGVRGYDHRLVEFVYEGIDEETRHLIGSLPEG
RGVLGALIEEPKPIRLDDISRHPASVGFPLHHPPMRTFLGVPVRIRDEVF
GNLYLTEKADGQPFSDDDEVLVQALAAAAGIAVDNARLFEESRTREAWIE
ATRDIGTQMLAGADPAMVFRLIAEEALTLMAGAATLVAVPLDDEAPACEV
DDLVIVEVAGEISPAVKQMTVAVSGTSIGGVFHDRTPRRFDRLDLAVDGP
VEPGPALVLPLRAADTVAGVLVALRSADEQPFSDKQLDMMAAFADQAALA
WRLATAQRQMREVEILTDRDRIARDLHDHVIQRLFAVGLTLQGAAPRARV
PAVRESIYSSIDDLQEIIQEIRSAIFDLHAGPSRATGLRHRLDKVIDQLA
IPALHTTVQYTGPLSVVDTVLANHAEAVLREAVSNAVRHANATSLAINVS
VEDDVRVEVVDDGVGISGDITESGLRNLRQRADDAGGEFTVENMPTGGTL
LRWSAPLR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)59
MHC class II prediction (Propred)67
MHC class 1 prediction (Propred1)385
CTL epitope prediction (CTLpred)92
Prediction of interferon-gamma inducing peptides (IFNepitope)233
Prediction of IL4 inducing peptides (IL4pred)371