Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313659166
StrainMtb_KZN_V2475
Protein IDZP_07816046.1
Description 3-oxoacyl-(acyl carrier protein) synthase II [Mycobacterium tubercul
Sequence MTELVTGKAFPYVVVTGIAMTTALATDAETTWKLLLDRQSGIRTLDDPFV
EEFDLPVRIGGHLLEEFDHQLTRIELRRMGYLQRMSTVLSRRLWENAGSP
EVDTNRLMVSIGTGLGSAEELVFSYDDMRARGMKAVSPLTVQKYMPNGAA
AAVGLERHAKAGVMTPVSACASGAEAIARAWQQIVLGEADAAICGGVETR
IEAVPIAGFAQMRIVMSTNNDDPAGACRPFDRDRDGFVFGEGGALLLIET
EEHAKARGANILARIMGASITSDGFHMVAPDPNGERAGHAITRAIQLAGL
APGDIDHVNAHATGTQVGDLAEGRAINNALGGNRPAVYAPKSALGHSVGA
VGAVESILTVLALRDQVIPPTLNLVNLDPEIDLDVVAGEPRPGNYRYAIN
NSFGFGGHNVAIAFGRY
B cell epitope (IEDB)1
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)35
MHC class II prediction (Propred)56
MHC class 1 prediction (Propred1)269
CTL epitope prediction (CTLpred)71
Prediction of interferon-gamma inducing peptides (IFNepitope)165
Prediction of IL4 inducing peptides (IL4pred)279