Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313659271
StrainMtb_KZN_V2475
Protein IDZP_07816151.1
Description esat-6 like protein esxP [Mycobacterium tuberculosis KZN V2475]
Sequence MATRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAE
ATSLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
B cell epitope (IEDB)0
T cell epitope (IEDB)17
MHC binder (IEDB)315
Vaccine TargetYes
B cell prediction (LBtope)3
MHC class II prediction (Propred)9
MHC class 1 prediction (Propred1)59
CTL epitope prediction (CTLpred)8
Prediction of interferon-gamma inducing peptides (IFNepitope)38
Prediction of IL4 inducing peptides (IL4pred)66