Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313659273
StrainMtb_KZN_V2475
Protein IDZP_07816153.1
Description phospholipase C 3 plcC [Mycobacterium tuberculosis KZN V2475]
Sequence MVSQGAFAGMSRRAFLAKAAGAGAAAVLTDWAAPVIEKAYGAGPCSGHLT
DIEHIVLCLQENRSFDHYFGTLSAVDGFDTPTPLFQQKGWNPETQALDPT
GITLPYRINTTGGPNGVGECVNDPDHQWIAAHLSWNGGANDGWLPAQART
RSVANTPVVMGYYARPDIPIHYLLADTFTICDQYFSSLLGGTMPNRLYWI
SATVNPDGDQGGPQIVEPAIQPKLTFTWRIMPQNLSDAGISWKVYNSKLL
GGLNDTSLSRNGYVGSFKQAADPRSDLARYGIAPAYPWDFIRDVINNTLP
QVSWVVPLTVESEHPSFPVAVGAVTIVNLIRVLLRNPAVWEKTALIIAYD
EHGGFFDHVTPLTAPEGTPGEWIPNSVDIDKVDGSGGIRGPIGLGFRVPC
FVISPYSRGGLMVHDRFDHTSQLQLIGKRFGVPVPNLTPWRASVTGDMTS
AFNFAAPPDPSPPNLDHPVRQLPKVAKCVPNVVLGFLNEGLPYRVPYPQT
TPVQESGPARPIPSGIC
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)138
MHC class II prediction (Propred)130
MHC class 1 prediction (Propred1)653
CTL epitope prediction (CTLpred)136
Prediction of interferon-gamma inducing peptides (IFNepitope)359
Prediction of IL4 inducing peptides (IL4pred)721