Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313660124
StrainMtb_KZN_V2475
Protein IDZP_07817004.1
Description NADH dehydrogenase subunit G [Mycobacterium tuberculosis KZN V2475]
Sequence MTQAADTDIRVGQPEMVTLTIDGVEISVPKGTLVIRAAELMGIQIPRFCD
HPLLEPVGACRQCLVEVEGQRKPLASCTTVATDDMVVRTQLTSEIADKAQ
HGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRTDSRFTEAKRTFAKP
INISAQVLLDRERCILCARCTRFSDQIAGDPFIDMQERGALQQVGIYADE
PFESYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVCEHCASGCAQR
TDHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFTYATQPDVITTPLIRDGG
DPKGALVPTSWSHAMAVAAQGLAAARGRTGVLVGGRVTWEDAYAYAKFAR
ITLGTNDIDFRARPHSAEEADFLAARIAGRHMAVSYADLESAPVVLLVGF
EPEDESPIVFLRLRKAARRHRVPVYTIAPFATGGLHKMSGRLIKTVPGGE
PAALDDLATGAVGDLLATPGAVIMVGERLATVPGGLSAAARLADTTGARL
AWVPRRAGERGALEAGALPTLLPGGRPLADEVARAQVCAAWHIAELPAAA
GRDADGILAAAADETLAALLVGGIEPADFADPDAVLAALDATGFVVSLEL
RHSAVTERADVVFPVAPTTQKAGAFVNWEGRYRTFEPALRGSTLQAGQSD
HRVLDALADDMGVHLGVPTVEAAREELAALGIWDGKHAAGPHIAATGPTQ
PEAGEAILTGWRMLLDEGRLQDGEPYLAGTARTPVVRLSPDTAAEIGAAD
GEAVTVSTSRGSITLPCSVTDMPDRVVWLPLNSAGSTVHRQLRVTIGSIV
KIGAGS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)64
MHC class II prediction (Propred)85
MHC class 1 prediction (Propred1)543
CTL epitope prediction (CTLpred)120
Prediction of interferon-gamma inducing peptides (IFNepitope)364
Prediction of IL4 inducing peptides (IL4pred)550