Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 313660612 |
| Strain | Mtb_KZN_V2475 |
| Protein ID | ZP_07817492.1 |
| Description | hypothetical protein MtubKV_19410 [Mycobacterium tuberculosis KZN V2 |
| Sequence | MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQ FNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDG LFT |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 15 |
| MHC class II prediction (Propred) | 18 |
| MHC class 1 prediction (Propred1) | 139 |
| CTL epitope prediction (CTLpred) | 20 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 38 |
| Prediction of IL4 inducing peptides (IL4pred) | 107 |