Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315444975
StrainM_gilvum_Spyr1
Protein IDYP_004077854.1
Description NAD-dependent aldehyde dehydrogenase [Mycobacterium gilvum Spyr1]
Sequence MTASDVINPATEEVLRTVEHTDEAGVDDAVARAKAAQRSWARQAPAERAA
ALRAFAAVVDAHVEELAALEVANSGHPIGNARWEAGHVRDVLQYYSASPE
RLSGKQIPVAGGLDVTFNEPLGVVGVITPWNFPMTIASWGFAPALAAGNA
VLVKPAEWTPLTTIRLGELAVEAGLPADLFQVLPGRGSVVGERFVTHPDV
RKIVFTGSTEVGTRVMAQAATQVKRVTLELGGKSANIVFDDCDLERAAAT
APYGVFDNSGQDCCARSRILVQRSVFDRFMELLEPAVKGVVVGDPGAEGT
EMGPLVSKAHWNSVSSYVPDDAPVAFRGSAPQGPGFWFPPTVLTPARDDR
TVVEEIFGPVVTVLPFDDEADAIALANDTVYGLSGSIWTDNISRAMRVSR
AVEAGNLSVNSHSSVRYSTPFGGFKQSGLGRELGPDAPLSFTETKNVFFA
VEEN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo