Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315444993
StrainM_gilvum_Spyr1
Protein IDYP_004077872.1
Description 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium gilv
Sequence MNERLRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNRDLLARQR
AETGVTNIAVADEAAAAALGEVTYSGPDAVTRLVEATEADVVLNGLVGAL
GLKPTLAALATGARLALANKESLVAGGPLVQKAAAPGQIVPVDSEHSALA
QCLRGGSADEVATLVLTASGGPFRGWSADRLEDVTPEQAGAHPTWSMGPM
NTLNSASLVNKGLELIETHLLFGIDYDRIDVVVHPQSIVHSMVTFTDGST
LAQASPPDMKLPIALALGWPARVAGAAAACDFSTASRWDFEPLDDEVFPA
VALAREAGKTGGCMTAIYNAANEEAAEAFLAGRIRFPAIVRTIAEVLRAA
DQWAAEPATVDDVLDAQNWARDRARSAVERESAGSRS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo