Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445054
StrainM_gilvum_Spyr1
Protein IDYP_004077933.1
Description acyl-CoA transferase/carnitine dehydratase [Mycobacterium gilvum Sp
Sequence MTEPAPDPARPLAGVRVVEISSFVAVPLAGMTLAQLGAEVLRVDPVGGAA
DYRRWPLTESGDSIYWAGLNKGKKSLAVDMRSGQGQALVARLIADAGVFI
TNVAGRQWHSYDVLRTDRPDLIHAEVSGRHDGGTGVDYTVNAAIGFPLVT
GPPELSTPVNHVLPAWDVTCGIYTALSVVTALRHRDATGHGQQISIPLEN
VALATAGNLSLLTEAMINGTSRQRIGNAVYGTYGQNFTSSDGVSFMVVAL
TGRHFRDLNALTGTTESVAALSRSLDVDFSDEGERYRHREALGGLYAEWF
SAHTGAEISAALSATSVLWERYQTFAETAADARVTDNPLFTELDQPRVGT
HLAAGLPVSIDGVYPRAVPAPALGDDTDSVLGDWLSLDAARIDELRETGT
VA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo