Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445099
StrainM_gilvum_Spyr1
Protein IDYP_004077978.1
Description redox protein- regulator of disulfide bond formation [Mycobacterium
Sequence MTELWVERTGVRRYTGRSTRGAEVLVGSEDVEGVFTPGELMKIALAACSG
LSSDQPLRRRLGDDYRAKIRVSGAADREQERYPLLEEKLEVDLSGLSDDE
KARLVTVVERAIDQVCTVGRTLKSGTEVTFEVGDAGGE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo