Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445100
StrainM_gilvum_Spyr1
Protein IDYP_004077979.1
Description bifunctional DNA-(apurinic or apyrimidinic site) lyase/formamidopyr
Sequence MPELPEVEVVRRGLAAHVTGRTISAVRVHHPRAVRRHEAGPADLTARLLD
SVITGTGRRGKYLWLTLGDGSAVVVHLGMSGQMLLGPVRNENHLRIAVLL
DDGTALSFVDQRTFGGWMLADLVTVDGSDVPAPVAHIARDPLDPLFDRAA
VVNVLRRKHSEIKRQLLDQTVVSGIGNIYADESLWRAKINGARLASGVSK
AKLAELLDAATDVMTDALAQGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EPCRRCGAIMRRDKFMNRSSFYCPRCQPRPRV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo