Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445251
StrainM_gilvum_Spyr1
Protein IDYP_004078130.1
Description transposase [Mycobacterium gilvum Spyr1]
Sequence MIDLSRSTWHYRTNPRPPVSDPLPQKHRAYPSRIDEADRAVIRDKILAGW
EAGSSVDHAFAASWDEGVMLASRRSWWRIAAAIEDQSARPVAPTRSTSKT
PRQAPVLKATGPQQIWSWDITDLRSPWRGVAFKAYSILDIYSRKIVGWRV
EERECDDLAVDMFEAAFAGHGLPAVVHADSGPAMRSTVLKDLLAGLKIGQ
THNRPRVSNDNPFSESEFRTMKYRPNYPGVFTDLDSARAWVSAYVSWYNQ
HHRHSGVELFTPDSVHDGTWAQLWDRRDTALQAYYDAHPERFRNRPRTKS
PSPVVGINLPTENDPDRLQAA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo