Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445323
StrainM_gilvum_Spyr1
Protein IDYP_004078202.1
Description hypothetical protein Mspyr1_37650 [Mycobacterium gilvum Spyr1]
Sequence MSDGPDNKPEFTDAQKGQIRKAYQGLTAGMQGLDLSSLMPALAQIQRDAM
PKLDVIAKSLVPTQNFGVDFAESLHVNIPKFKLDLPPLQLDYTRLLGPAL
NIENLGLKNLIDTSSIKVFDKIYADQRKQFEGIFENFRQIIDRMLPPNGS
AARIGDI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo