Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445398
StrainM_gilvum_Spyr1
Protein IDYP_004078277.1
Description small-conductance mechanosensitive channel [Mycobacterium gilvum Sp
Sequence MNTTVLAFDMAGAWRGFWQGDTGVWILGRGVPIALLLIGGLLAARFINWS
ARRITRRIDAQYLESDQLVRTESAKHRQAVASVISWVSVALLFVMVAVQI
TDILAIPIGSLVAPAAVIGAALGFGAQKLVQDLLAGFFIITERQYGFGDL
VELNMVGAPQAAQGTVEEVTLRVTKLRTSEGEVFTVPNGNIVQSLNMSKD
WARAVVDIPVPTTVDLNRVNEVLHRVGETAMQDDELRALLLDTPQLMGVE
SIEVDTVNLRMVARTLPGKQFEVGRRLRILIIAALAGAGISTQEHTPVVS
NISADGDTASSEADARSRAEQKS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo