Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445489
StrainM_gilvum_Spyr1
Protein IDYP_004078368.1
Description F420-dependent methylene-tetrahydromethanopterin reductase [Mycobac
Sequence MRIGLSTPVVVQTPAAASPWEAGAGICDIARIAETADDLGFDYLTCSEHV
AVPVGDAAVRGATYWDPLATLGFLAARTARIRLATSVLVLGYHHPLEIAK
RYGTLDRVSGGRLILGVGVGSLQPEFDLLGAPWEERGARADDAIRALRSS
LSVAEPSYDGDFYTFGGMVVEPHAEQPRVPIWVGGRSRRSLRRAVGLADG
WMPFGLRTMQIADMLATVDIPDGFDIVLPAGPLDPREPSGCLTRLRALRD
VGATAVTCSVAADSTDHYCAQLASLRGIVDEL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo