Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445620
StrainM_gilvum_Spyr1
Protein IDYP_004078499.1
Description 5-(carboxyamino)imidazole ribonucleotide mutase [Mycobacterium gilv
Sequence MSSPRVGLIMGSDSDWPVMSEAAEALAEFEVPFEVGVVSAHRTPARMLTY
AQDAADRGIEVIIAGAGGAAHLPGMVASATPLPVIGVPVPLARLDGMDSL
LSIVQMPAGVPVATVSIGGARNAGLLAVRILGASDKALQERMIAFQASLE
EMVLQKDEALRQKLLGE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo