Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445644
StrainM_gilvum_Spyr1
Protein IDYP_004078523.1
Description type II secretory pathway- component ExeA ( ATPase) [Mycobacterium
Sequence MSIQRLQSHWGFSRMPFGRDLAPSMLHRHPGHSEAIARISWCVDQCAIGV
ITGEVGAGKTVAIRAAATALDPARHVIIYLANPTIGVRGMLTHIVAALGH
TPVFHTARLAPQAADALAAEHAERGRSPVLVVDEAHLLDNGQLEAIRLLT
NHDMDSGSPFAVVLVGQPTLRHRLRLGVLAALDQRIAVRYTLPGMTPADT
ADYINHHTKIAGRSDVLFADDAITLIHNASRGHPRAVNNLALHALTAAFA
AGHSIVGEKAARIAISETATD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo