Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445706
StrainM_gilvum_Spyr1
Protein IDYP_004078585.1
Description SufE protein probably involved in Fe-S center assembly [Mycobacteri
Sequence MSMPAALAEVVSDFKEVEGQDKLALLLEFADELPPLPAELEEAAMEPVPE
CQSPLFLHVDAGDRGHVRLFFSAPAEAPTTRGFAAILATGLDGQSAADIL
AVPDDFYTDLGLAKLISPLRLRGMSAMLTRIKKRLT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo