Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445740
StrainM_gilvum_Spyr1
Protein IDYP_004078619.1
Description fatty acid desaturase [Mycobacterium gilvum Spyr1]
Sequence MTELLETTPQRTISKTVAGKTITMTPDQLDAFGKELDALKESVIADLGER
DATYIRRMIKAQRGLEIGGRALLFGGIFPPFWLAGTTMLGLSKIIDNMEI
GHNVMHGQYDWMGDPAISSKGFEWDTACPADQWRHSHNYMHHTYTNIVGL
DRDIGYGILRMSSDQKWRPYYLGNPVYAFLLMVLFQYGVALHEMESEKIA
AGEITLTDKREILREIWAKTKRQTLKDYVAFPLLAGPFAPWVFAGNLTAN
LMRNVWSYMIIFCGHFPEDVQEFSIEETKAETRGQWYFRQVLGSANLTGG
KLFHILSGNLSFQIEHHLFPDIPAFRHAEIAPKVREICERYGVPYNTGPL
PRQFASVVRKIVKFALPF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo