Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445794
StrainM_gilvum_Spyr1
Protein IDYP_004078673.1
Description response regulator containing a CheY-like receiver domain and an HT
Sequence MSAASPLLRPRDGDALRAELRRVAALGGVPVLFGGEIHEDTLLISEYYGL
RTAGLRGLAVRSSSGLGGASMVAGRPLAVADYRNASSITHDYDGPVLSEG
IRSVLAVPVLVDGQARAMLYGAYRTGAPFGGRAADLVVESARRLSEEFRI
RDEVDRRLRMRDAQSAGGQVSDEQIREVHAELRLLAVTAPPPLQDRLRAL
ADTLSGTGTEPGAGPGAATLAPRELDVLAQVALGCTNAEAAQRLSLKPET
VKSYLRSAATKLGTRTRYESVSKARRLHLIP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo