Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445795
StrainM_gilvum_Spyr1
Protein IDYP_004078674.1
Description acyl-CoA synthetase/AMP-acid ligase [Mycobacterium gilvum Spyr1]
Sequence MATNTDLFRSARDHLVDVMADYDKALDTFEWPRIAGSFNWATDWFDAIAA
DPASADRPALWIVEEDGREQKVTFAQMAHRSDQVATWLQGLGVGKGDRVI
LMLGNQVELWESMLAVAKLGAVIMPTTGALGSEDLADRIRRGGAGYVIAN
AADAPKFDGVDGDYVRIAVGGGADGWHTYADSAHADAHTHDPQTTAGDPL
LVYFTSGTTSKPKLVEHSQISYPVGHMTTMAWLGVRPGDVHLAISAPGWA
KHAWSCFFAPWIAEATIFVYNYGRFQAPALLDQIRRAGVNTFCAPPTVWR
MLIQSDLGERPEGLRELLGAGEPLNPEVISAVEQAWGLTIRDGFGQTETT
LQIGNTPGQPVKAGSMGRPMPGVPVVLVDPLTGELADEGEICLDLSGTPL
NLMTGYLGDDERNAQVMRDGYYHTGDVASRDADGYITYIGRTDDVFKSSD
YKVSPFELESVLIEHPAVVEAAVVPQPDDTRLAVPKAYIALADGWSADES
TAKAILEHSRDHLAPYLKVRRLEFADLPKTISGKIRRVELRRREEDAHRS
GAPIESEYRYEDLVN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo