Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445854
StrainM_gilvum_Spyr1
Protein IDYP_004078733.1
Description Co-chaperonin GroES [Mycobacterium gilvum Spyr1]
Sequence MASVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGR
WDEDGEKRIPLDVSEGDVVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
gene ID315445854
StrainM_gilvum_Spyr1
Protein IDYP_004078733.1
Description Co-chaperonin GroES [Mycobacterium gilvum Spyr1]
Sequence MASVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGR
WDEDGEKRIPLDVSEGDVVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
B cell epitope (IEDB)91
T cell epitope (IEDB)75
MHC binder (IEDB)77
Vaccine TargetNo