Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315445903
StrainM_gilvum_Spyr1
Protein IDYP_004078782.1
Description translation initiation factor 1 (bIF-1) [Mycobacterium gilvum Spyr1
Sequence MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLTRGRIVYRYK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo