Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315446127
StrainM_gilvum_Spyr1
Protein IDYP_004079006.1
Description Mn2+/Fe2- transporter NRAMP family [Mycobacterium gilvum Spyr1]
Sequence MATPEEPLNPSVDTAPKPSEPARTALLGAMFLMATSAVGPGFITQTTEFT
VELGAAFAFAILASIVIDFAVQMNVWRVIGVAGIRAHELGNKVLPGVGYA
LAVLVVVGGLVFNIGNTSGAGLGTDAMFGLDPRIGGAISALIAIAIFLSK
RAGIALDRIVVVLGIAMIAMTAYTAIVSRPPLGEALRNAVLPEQISFLAI
TTIVGGTVGGYITYAGAHRLLDTGITGPENVSRITLGSTYAIIVTGIMRA
LLFLAILGVTAGGVSLASDNPTASAFEYALGAAGGIIFGVILWAASITSV
IGAAYTSVSFLTKSTTPRRRQNILTVGFIALSAALFVILGAAPVTLLVFA
GAFNGLILPIGFTVVLWVAWVRRDLLGGYRYPMWLKIVGLAVWLLTLYLG
WNSLSGLSSLWS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo