Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315446251
StrainM_gilvum_Spyr1
Protein IDYP_004079130.1
Description GTP cyclohydrolase I [Mycobacterium gilvum Spyr1]
Sequence MTRSHNHSATLTTPDFDQARAEAAVRELLIAVGEDPDREGLRDTPARVAR
SYREIFAGLYTDPDEVLTTMFDEQHDEMVLVKDIPMYSTCEHHLVSFHGV
AHVGYIPGVDGRVTGLSKLARVVDLYAKRPQVQERLTAQIADALMRKLDP
RGAIVVIEAEHLCMAMRGIRKPGAVTTTSAVRGQFKTDKASRAEALDLIL
RK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo