Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315446253
StrainM_gilvum_Spyr1
Protein IDYP_004079132.1
Description hydrolase or acyltransferase of alpha/beta superfamily [Mycobacteri
Sequence MQSRMVHTNGITLRVFEAGERSAPVVVLCHGFPELAFTWRHQISALAAAG
FHVLAPDQRGYGGSDKPGDAGVYNVAELTADVVGLLDDVGAERAALVGHD
FGAVVAWGAPLLEPDRFSAVAGLSLPPVPRPQVPTTQAFRRVFGDRFMYI
LYFQEPGPADAELARDPATTFRRLFALTTGGAEMVGDAGPQGFLDRIPEP
GGLPDWISQADFDVYVDEFTRGGFTGPLNWYRCFDRNWELTAETPAPTIE
VPALFVGGTEDATLAYTPRDRVREVVTGDYREVMIDGAGHWLTEERPDEV
SRVLVDFLTTVR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo