Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315446440
StrainM_gilvum_Spyr1
Protein IDYP_004079319.1
Description amino acid ABC transporter ATP-binding protein [Mycobacterium gilvu
Sequence MTTDTCVAAREVHKSFGPLEVLKGVSFTVARGSATAIIGPSGSGKTTLLR
TLNALDVADSGVITVGDVEIDFARPVSKDQLRRYRAQSGFVFQAHNLFPH
MTVLQNVTEGPVVAQRRPRDEVEAEALELLDQVGLKDKRDAYPFQLSGGQ
QQRVGIARALALKPKVVLFDEPTSALDPELVGEVLGVIRDLAVQGWTLVV
VTHEIQFARGVSDQVLFTDQGVILEQGSPAEVIGDPKEERTRQFLQRILN
PL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo