Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315446466
StrainM_gilvum_Spyr1
Protein IDYP_004079345.1
Description transglutaminase-like enzyme- cysteine protease [Mycobacterium gilv
Sequence MKRDVGAELDVEITDPTTLEFQIAVAPQPGAEVTESLSFVLDGREIPLSE
IHEISGDHGNRIHKLEAPVGNLKVSYSATVIGQADPAPVRDLDLSTYLRP
SRYAEADKFFGFAGTEFGDIADSATILEKISSWVGARLNYVPGSSDPIDG
AADTLLAGSGVCRDYAHLVVALLRAVNVPARLVSVYAPGCQPMDFHAVAE
AFVDGQWRVVDATLLAPRQSLVRIATGRDAADTAWLDNHKGQITVNNMEV
FATVDGDLPRDSIDQLVSIR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo