Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315446478
StrainM_gilvum_Spyr1
Protein IDYP_004079357.1
Description hypothetical protein Mspyr1_49920 [Mycobacterium gilvum Spyr1]
Sequence MTVLFLVTIVCVVANAAIAIADYAKAGFVLRNSAQVHVPVSALPYLATAK
LAGAVGLVIGLVAVPWVGVAAGIGLVLFFIGAVGAHGRARVFHNIAFPGF
YLLLSAASTVYMAQLAGGG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo