Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315446502
StrainM_gilvum_Spyr1
Protein IDYP_004079381.1
Description acetyl-CoA carboxylase- carboxyl transferase subunit alpha [Mycobac
Sequence MTERTTAELLADLREKLELAKEPGGEKAVAKREKKGIPSARARIHSLLDP
GSFLEIGALAKTPGDPDALYGDGVVTGHGTINGRPVGVFSHDQTVFQGSV
GEMFGRKVAKLMEWVAMVGCPIIGINDSAGARIQDTATSLAWYAELGRRH
ELLRGLVPEISLIFGKCAGGAVYSPIQTDLVVAVRDQGYMFVTGPDVIKD
VTGEDVTLDELGGADAQARYGNIHQVVESEAAAFQYVRDYLSFLPANTFD
DAPIVNPGLEPEITPHDLELDAIVPDSDNQAYDMMEILLRIFDDGDVFQV
AEQAGPAIITAFARVDGRPVGVIANQPMYMSGAIDNEASDKAARFVRFCD
SFNTPLVFVVDTPGFMPGVEQEKGGIIKRGGRFLNAVVEASVAKVTITIR
KSYGGAYAVMGSKQLTSDFNFAWPTARIAVIGADGAAQLLVKRFPDPTAP
EVQKIKADFIEGYNANLAVPWIAAERGFIDGVIEPHETRLLLRKCLHLLA
DKQINRVHRKHGLTPI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo