Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315446510
StrainM_gilvum_Spyr1
Protein IDYP_004079389.1
Description 4-hydroxybenzoate polyprenyltransferase [Mycobacterium gilvum Spyr1
Sequence MSTSEVARDANSTAGPPKNIVTGVIKAIRPRQWVKNLLVLAAPIAALGGD
IRYDYDEMAINILIAFVAFSLAASCIYLVNDSRDVEADRQHPTKRFRPIA
AGVVPEWLAYTLAVVLGLAALGISLLASVNLTLVIGVYILMQLAYCFGLK
HQAVLDICIVSSAYLIRAIAGGAAAGIPLSQWFLLVMTFGSLFMVAGKRY
AELQLAERTGAKIRKSLESYTASYLRFVWTVAATSMVVCYSLWAFERDGA
AASWYAVTIIPITIAILRYAVDVDGGLAGEPEEIALKDRVLQLLLLTWIG
TIGAAVFLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo