Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID315446804
StrainM_gilvum_Spyr1
Protein IDYP_004079683.1
Description transcriptional regulator [Mycobacterium gilvum Spyr1]
Sequence MASPDDPEDYQDRAAPAAHRVRAGTMLLANTDLLEPTFRRSVIYVVEHND
GGTLGVVLNRASETAVYNVLPQWAKLAVKPKTMFIGGPVKRDAALCLGTL
RVGSDPVGVPGLRHVQGRIVMVDLDADPDELAPILEGVRIFAGYSGWTIG
QLEGEIERDDWIVLSALPTDVLVEPKVDLWARILRRQPMPLSLLATHPID
LSRN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo