Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31791331
StrainM_bovis_AF2122_97
Protein IDNP_853824.1
Description phosphotyrosine protein phosphatase PtpB [Mycobacterium bovis AF2122/97
Sequence MAVRELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAGRATLRRLGIT
DVADLRSSREVARRGPGRVPDGIDVHLLPFPDLADDDADDSAPHETAFKR
LLTNGGSNGESGESSQSINDAATRYMTDEYRQFPTRNGAQRALHRVVTLL
AAGRPVLTHCFAGKDRTGFVVALVLEAVGLDRDVIVADYLRSNDSVPQLR
ARISEMIQQRFDTELAPEVVTFTKARLSDGVLGVRAEYLAAARQTIDETY
GSLGGYLRDAGISQATVNRMRGVLLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)31
MHC class 1 prediction (Propred1)194
CTL epitope prediction (CTLpred)45
Prediction of interferon-gamma inducing peptides (IFNepitope)122
Prediction of IL4 inducing peptides (IL4pred)142