Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31792453
StrainM_bovis_AF2122_97
Protein IDNP_854946.1
Description hypothetical protein Mb1292c [Mycobacterium bovis AF2122/97]
Sequence MDISRWLERHVGVQLLRLHDAIYRGTNGRIGHRIPGAPPSLLLHTTGAKT
SQPRTTSLTYARDGDAYLIVASKGGDPRSPGWYHNLKANPDVEINVGPKR
FGVTAKPVQPHDPDYARLWQIVNENNANRYTNYQSRTSRPIPVVVLTRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)13
MHC class II prediction (Propred)21
MHC class 1 prediction (Propred1)99
CTL epitope prediction (CTLpred)32
Prediction of interferon-gamma inducing peptides (IFNepitope)34
Prediction of IL4 inducing peptides (IL4pred)95