Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31793316
StrainM_bovis_AF2122_97
Protein IDNP_855809.1
Description undecaprenyl pyrophosphate phosphatase [Mycobacterium bovis AF2122/97]
Sequence MSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFTAVSQLG
TEAAVVIYFARDIVRILSAWVHGLVVKAHRNTDYRLGWYVIIGTIPICIL
GLFFKDDIRSGVRNLWVVVTALVVFSGVIALAEYVGRQSRHIERLTWRDA
VVVGIAQTLALVPGVSRSGSTISAGLFLGLDRELAARFGFLLAIPAVFAS
GLFSLPDAFHPVTEGMSATGPQLLVATLIAFVLGLTAVAWLLRFLVRHNM
YWFVGYRVLVGTGMLVLLATGTVAAT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)92
MHC class 1 prediction (Propred1)210
CTL epitope prediction (CTLpred)69
Prediction of interferon-gamma inducing peptides (IFNepitope)114
Prediction of IL4 inducing peptides (IL4pred)151