Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31794122
StrainM_bovis_AF2122_97
Protein IDNP_856615.1
Description lipoprotein LppX [Mycobacterium bovis AF2122/97]
Sequence MNDGKRAVTSAVLVVLGACLALWLSGCSSPKPDAEEQGVPVSPTASDPAL
LAEIRQSLDATKGLTSVHVAVRTTGKVDSLLGITSADVDVRANPLAAKGV
CTYNDEQGVPFRVQGDNISVKLFDDWSNLGSISELSTSRVLDPAAGVTQL
LSGVTNLQAQGTEVIDGISTTKITGTIPASSVKMLDPGAKSARPATVWIA
QDGSHHLVRASIDLGSGSIQLTQSKWNEPVNVD
B cell epitope (IEDB)0
T cell epitope (IEDB)32
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)24
MHC class 1 prediction (Propred1)142
CTL epitope prediction (CTLpred)22
Prediction of interferon-gamma inducing peptides (IFNepitope)77
Prediction of IL4 inducing peptides (IL4pred)159