Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31794677
StrainM_bovis_AF2122_97
Protein IDNP_857170.1
Description hypothetical protein Mb3531c [Mycobacterium bovis AF2122/97]
Sequence MIQQLAVPARAVGGFFEMSMDTARAAFRRPFQFREFLDQTWMVARVSLVP
TLLVSIPFTVLVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVV
AGAGATAICADLGARTIREEIDAMRVLGIDPIQRLVVPRVLASTLVALLL
NGLVCAIGLSGGYAFSVFLQGVNPGAFINGLTVLTGLRELILAEIKALLF
GVMAGLVGCYRGLTVKGGPKGVGNAVNETVVYAFICLFVINVVMTAIGVR
ISAQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)5
MHC class II prediction (Propred)72
MHC class 1 prediction (Propred1)184
CTL epitope prediction (CTLpred)49
Prediction of interferon-gamma inducing peptides (IFNepitope)107
Prediction of IL4 inducing peptides (IL4pred)168