Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31794790
StrainM_bovis_AF2122_97
Protein IDNP_857283.1
Description hypothetical protein Mb3644c [Mycobacterium bovis AF2122/97]
Sequence MDLPGNDFDSNDFDAVDLWGADGAEGWTADPIIGVGSAATPDTGPDLDNA
HGQAETDTEQEIALFTVTNPPRTVSVSTLMDGRIDHVELSARVAWMSESQ
LASEILVIADLARQKAQSAQYAFILDRMSQQVDADEHRVALLRKTVGETW
GLPSPEEAAAAEAEVFATRYSDDCPAPDDESDPW
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)11
MHC class 1 prediction (Propred1)106
CTL epitope prediction (CTLpred)19
Prediction of interferon-gamma inducing peptides (IFNepitope)91
Prediction of IL4 inducing peptides (IL4pred)131