Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333989377
StrainMycobacterium_sp_JDM601
Protein IDYP_004521991.1
Description enoyl-CoA hydratase [Mycobacterium sp. JDM601]
Sequence MTPDTDVLLRTDRDGVRTLILNRPARKNAINPQLWRALRDALRDAADDRD
LRALVITGAGGAFCSGADIGTGDDTHPVYKLQRLTDVALALHELAIPTIA
KVTGVAVGAGWNLALGCDLVVATPESTFCQIFSKRGLSIDLAGSWLLPKI
VGLQQAKRLALLAETIDATEAQALNLVTWVIGAGEIDGFVDDLADRLAAG
PPRALAQTKMLLNQGADCTLPEALLNESRAQLVNFAGTDAAEAYAAFAER
RTPRFTGGWPAK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo