Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333989545
StrainMycobacterium_sp_JDM601
Protein IDYP_004522159.1
Description bifunctional purine biosynthesis protein PurH [Mycobacterium sp. JD
Sequence MTDGKRPIRRALISVYDKTGLVDLATGLHAAGVDIVSTGSTAKTIAAKGI
PVTPVEQLTGFPEVLDGRVKTLHPRVHAGLLADLRKPEHAAALGELDIAP
FELVVVNLYPFSETVDSGAGMDECVEQIDIGGPSMIRAAAKNHPSVAVVV
DPLGYDGVLAAVNAGGFTLAERKRLASLAFRHTAEYDVAVAGWMSSTLAP
EEPRQPMPEWFGRSYRRAAQLRYGENPHQQAALFCDGGAWPGLAQADQLH
GKEMSYNNFTDADAAWRAAFDHEETCVAIIKHANPCGIAISSISVADAHR
KAHECDPLSAFGGVIAANTEVSAEMAEYVSTIFTEVIVAPAYESGAVEIL
ARKKNIRVLLASEPLRGGVEWRQISGGLLMQSRDGLDAAGDNPVNWTLAT
GSPADPATMADLVFAWRSCRAVKSNAIVVAANGATVGVGMGQVNRVDAAR
LAVERGGDRVAGAVAASDAFFPFPDGLQTLTGAGVTAIVHPGGSVRDDEV
TAAAAEAGVTLYLTGARHFAH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo