Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333989567
StrainMycobacterium_sp_JDM601
Protein IDYP_004522181.1
Description acetyl-/propionyl-coenzyme A carboxylase subunit alpha AccA2 [Mycob
Sequence MISNVLVANRGEIARRVFATCRRLGLGTVAVYTDPDAAMPHVAEADAKVR
LPQTTSYLSAEAIIDAARAAGADAIHPGYGFLSENADFAAAVQDAGLTWI
GPPVAAVTSMGSKIESKKMMAAAGVPVLEELDPASVTAEQLPVLVKASAG
GGGRGMRVVTELSALADEVAAAQREAASAFGDPTVFCERYLPTGHHIEVQ
VMADAHGTVWAVGERECSIQRRHQKVLEEAPSPLVARTPGMRAKLFEAAR
LAASAIGYTGAGTVEFLADSRGEFYFLEMNTRLQVEHPVTEETTGVDLVE
LQIAVADGARLDPEPPPAHGYSIEVRLYAEDPGSGWQPQAGTVHAVDVPG
VAAQFGSLCRHTGIRLDSGVVDGSTVSIHYDPMLAKVISYAPTRRQAATV
LASALARTRLHGLRTNRDLLVNVLRHPAFLDGATDTAFFDTHGLAELSAP
LADTATVRTAAVAAALADAAHNRATAQAFGSVPGGWRNVPSGFQTKTYAA
DDGTEHRIEYRFTRTGLIVKDCDVRLVSAGPDEVVLADPAGVARTFTVAR
YGSDIYVDSPAGGVHLVALPRFPDPESAVEQGSLLAPMPGNVIRLGAGLG
DAVTAGQPLIWLEAMKMEHTISAPSDGVLTQLDVKPGDQVEVGAVLARVE
QQAEGDPE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo