Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333989853
StrainMycobacterium_sp_JDM601
Protein IDYP_004522467.1
Description (NAD) dependent malate oxidoreductase Mez [Mycobacterium sp. JDM601
Sequence MDNSPIVIGDEEIFEAHMGGKISVDLKAPLDSQRALSIAYTPGVAQVSRA
IAADHTLAARYTWAHRLVAVVSDGTSVLGLGDLGPSASLPVMEGKAALFK
TFAGLDSIPIVLDTKDPDEIVETLVRLRPSFGAVNLEDISAPRCFEIERR
VIEALDCPVMHDDQHGTAIVALAALMGAAKVLGRDISSLRVVVSGAGAAG
VACANILMSVGISEIIVLDSQGVLHPERTDMNDVKTELAQRTNPGGRTGG
LAEALVGADVFLGASGGVVPEELIASMNPGGVVFALSNPDPEIHPELAAK
YAAVVATGRSDFPNQINNVLAFPGVFRGALDAGAERITEEMKLAAAEAIY
SVVADDLAPERVVPSPLDPRVEPAVAAAVAAAAGSSS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo