Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333990167
StrainMycobacterium_sp_JDM601
Protein IDYP_004522781.1
Description phenolpthiocerol synthesis type-I polyketide synthase PpsD [Mycobac
Sequence MTTHGAHRHAIPSNDTAEPIAIIGMGCRLAGDVTTPADFWRFLLDGRSAV
RQVPAERWEPYLRRDPRNAAVLRDTTPWGTFLDDLAGFDAEFFGVSPREA
ELMDPQQRLALEVCWEALEHAGIAPRSLAGSDTAVLMGVNADDYGKLIME
DLPGIEAWAGIGTALCGVANRVSHLLDLRGPSVALDAACAASLVAVHQAC
QQLRTGETSLALAGGVSALIGPGLTRVLDQAGATAPDGRSKTFDMAADGY
GRGEGAAVVVLKRLGDARRDGNPVLAVVRGGAVAHDGNTPGIMSPNGRAQ
EDLFRLACASAGIEPTSVDFVEAHGTGTPVGDRVELAALAAVYGAGRPSN
APCLIGSVKPNTGHLEGGAGVVGLIKAALALHQETIPPTAGISKLTTAID
WADSCLRVATEVEAWPRQPDSRRRAAVCSYGYGGTIAHIILEEAPPRPAE
HLGPVTAPAAVPVVIPISARTHARLARQADALADHLRARDCSVDQVAATL
WTRRSHERIRAAVLADNCDELVGGLDSLANDGQQPAVVTGAVVSGAPDGA
VWVFSGHGSHWEGMGSELLAHEPAFAAVIDEIDPVFQAELGFSARQALST
GELGATDRVQALTFAIQAGLAALLADRGVRPAAIIGHSVGEVAACVAAGV
LDLAQGAKVACYRARGFRRVAGHGAMALVGLSLEEAQRRLCQRSDVVAAI
SATPESAVVSGTVEAIDQICQRCSDDGISARRVNTDVAFHSPQMDALTDD
LARLTAGLPPADEPAVPLYTTALADPRSTAPRDSRYWVANLRGQVRFAEA
VIAAAEDGHRLFLEISAHPVVSHSIAETLSHLGLDEHGVVPTLRRQQPEL
RAVTRALASLYCHGAPFPHGVTATSPWTDNLPVTQWEHQHLWRTPTPPPS
GGGIHDVDSHTLLGGQVDITSAVPTRMWQTRLDMSNRPYPGDHPVQGTEI
VPAAVLLNTMLTAATTDLANVRLRTPVAPGRTRDIQVVLQEHCLSLASRL
VDSDDAPTAGGWLTHCTAVAEINNDGAAPVFELPAVQRRCTEVLPSTHVT
DLLESLGVTAMGFEWEILELRCGDGELLARVNAEPDGSTPATWAGLLDAA
TSTASVLFSDPGRLKMPARIERVAVHGPPCGEALLHARRRAAGAITDVVI
TDRAGTVLASMTGLAFEDLERSTERESSRLVHRLAWHPTPWRDTDRPDHV
TLIGGTDETRAWCTRDLAAAGVPTRSVADPAELPSGDAGSGSGAVVLVLT
EPRDEPRVSIELVLRTLKCLVGQGSKARLWVLTRNVHEGTDIEQAPLWGL
SRVAAAEHPQLWGGVLDLFEELSEPHLPVPALSSLTGHGVVVVRDGIAYT
ARLASAPCVGESMHCSPGGTYLITGGTGALGRQMAHRLVDLGARRLVLVS
RSGMPDRTVADAPTNPGLVQTVRSLEERGVFVRVAATDIGAAGAAAALQH
ALRDLPPVLGVVHAAGIETGALLTDTTLAQVDASMHAKVTGARVLDEVFP
PGTLNWMLLFSSCGYLTGFPGQGAYACGNAFLDAFARQRRNLGDRTISVA
WTAWRGLGMGSTSEYVAAQLESMGMETISADDAMWALDLAMRDDQANTVV
LPVTPLAASVAMLADIAPAESDVVESQDPVQAGLPEDPAEASDWVAERVS
AAIAGQLGLPDDGVDPHLPLIEMGVDSIMTVAVRRRLEKQIGLTLSPTLL
WEHPTAAAVTKKILELLA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo