Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333990291
StrainMycobacterium_sp_JDM601
Protein IDYP_004522905.1
Description meromycolate extension acyl carrier protein AcpM [Mycobacterium sp.
Sequence MPASQEEIIAGLAEIIEEVTGIEPSEVTVEKSFVDDLDIDSLSMVEIAVQ
TEDKYGVKIPDEDLAGLRTVGDVVGYIQKLEAENPEAAAALREKFGSESN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo