Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333990379
StrainMycobacterium_sp_JDM601
Protein IDYP_004522993.1
Description UDP-N-acetylmuramoylalanyl-D-glutamyl-2-6-diaminopimelate--D-alanyl
Sequence MIALTVAEIAAIVGGRLADISPEQAARTVVSGSVEFDSRRITAGSLFLAL
PGARADGHDHAASAVAAGAVAVLAARPVGVPAIVVDPGPKAASRSGALEH
DDASGSGATVLAALATLAAAVAARLVAEGLRIIGVTGSSGKTSTKDLIAT
VLAPLGQVVAPPGSFNNELGHPWTVLRADEHTDFLVLELSARHRGNIAEL
AAIAPPQLAVVLNVGSAHLGEFGSREAIAETKAELVQAVPESGVVILNVD
DSAVAAMADKTVARVVRVSRSAPADVWADAVVLDELARPRFALHAGGEAD
VTVSLGVSGDHQVGNALCAAAVALECGATPQQVADALAGAGPASGHRMQV
STRADGVTVIDDSYNANPDSMRAALQALAWIARGENPGAKRHSWAVLGEM
AELGEDAISEHDRIGRLAVRLDVSRLIVVGVGRAMGAMHHGAVMEGSWGA
EATAVQDVDAALALLRAELRSGDVVLVKASNSAGLTALADALVSDDPGDR
R
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo