Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333990951
StrainMycobacterium_sp_JDM601
Protein IDYP_004523565.1
Description carbamoyl-phosphate synthase large subunit CarB [Mycobacterium sp.
Sequence MPRRTDLRHVLVIGSGPIVIGQACEFDYSGTQACRVLKAEGLQVSLVNSN
PATIMTDPEYADHTYVEPITWEFVEKVLAQQAERGNKIDALLATLGGQTA
LNTAVALHEHGVLERYGVELIGADFEAIQRGEDRQQFKDIVARVGGESAR
SRVCYTMAEVEETVAELGLPVVVRPSFTMGGLGSGLAASLDEVARMAGDG
LAASPTANVLIEESIYGWKEFELELMRDGNDNVVVVCSIENVDPMGVHTG
DSVTVAPAMTLTDREYQRMRDLGIAILREVGVDTGGCNIQFAVDPEDGRL
IVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDEIVNDITGETPA
CFEPALDYVVVKAPRFAFEKFPGADPRLTTTMKSVGEAMSLGRNFIESLG
KVMRSLESDRAGFWTQPDPEEDSADDALQRLRVPTEGRLYDIELALRLGA
TVEQVAEASGVDPWFVDQINGLVALRAEVVDTPVLDADLLRRCKYNGLSD
HQIAALRPELAGEDGVRLLRSRLGIHPVFKTVDTCAAEFESKTPYHYSTF
ELDPAAETEVAPQDVKPKVLILGSGPNRIGQGIEFDYSCVHAAITLSQAG
FETVMVNCNPETVSTDYDTADRLYFEPLTFEDVLEVYYAEQQSGLGGPGV
VGVIVQLGGQTPLRLAQRLADAGVPIVGTTPEAIDLAEDRGAFGDVLTAA
GLPAPRYGTATTFEQAKRIAADIGYPVLVRPSYVLGGRGMEIVYDEETLR
GYITRAALLTPEHPVLVDRFLEDAIEIDVDALCDGTEVYIGGIMEHIEEA
GIHSGDSACALPPVTLGRSDIEKVRRATEAIAHGVGVVGLLNVQFALKDD
VLYVLEANPRASRTVPFVSKATAVPLAKACARVMLGATIAGLRTEGLLAA
SGDGASVGPHAPIAVKEAVLPFHRFRRADGSGIDSLLGPEMKSTGEVMGI
DRDFGTAFAKSQTAAYGSLPADGTVFVSVANHDKRSLVFPVKRLADLGFR
VLATEGTAEMLRRNGIPCDVVRKNFEEPSPQRPELTAVDAIRAGEVDLVI
NTPYGNSGPRVDGYEIRSAAVGVNIPCVTTVQGAAAAVQGIEAGIRGDIG
VRSLQELHSTLGGH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo