Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333991175
StrainMycobacterium_sp_JDM601
Protein IDYP_004523789.1
Description bifunctional polyribonucleotide nucleotidyltransferase GpsI [Mycoba
Sequence MSAIEIEEGVFESTATLDNGSFGTRTIRFETGRLAQQAAGSVVAYLDDET
MLLSATTASKAPKDHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLTDRPLRPSFVEGLRNEVQVVVTVLSLDPKDLYDVVAINAASAST
QLAGLPFSGPVGAARVALIDGSWVAFPTIEQLERATFDMVLAGRAVEATG
GGTDVAIMMVEAEATDNVIELIEAGAQAPTEAVVAEGLEAAKPFIAALCK
AQQELADAAARPTAEYPLFPPYGDDVYYSVASVATDELAKALTIAGKAER
DERTEEIKAEVVARLAETYEGREKEISAAYRSLTKKLVRQRILTDHFRID
GRGITDIRALSAEVAVIPRAHGSALFERGETQIMGVTTLDMMKMAQQIDS
LGPETSKRYMHHYNFPPYSTGETGRVGSPKRREIGHGALAERALVPVLPS
VEEFPYAIRQVSEALSSNGSTSMGSVCASTLALLNAGVPLKAPVAGIAMG
LVSDDVEVDGKTERRFVALTDILGAEDAFGDMDFKVAGTKDFVTALQLDT
KLDGIPSQVLAGALAQAKDARLTILEVMAEAIDAPDEMSPYAPRVTTIKV
PVDKIGEVIGPKGKMINSITEETGAQISIEDDGTVFVGATDGPSAQAAID
KINAIANPQLPKIGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGKGK
RVAKVEDVVKVGDKLRVEIADIDNRGKISLVPVEDSAESADSGQGSAQPV
DAAATES
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)3
Vaccine TargetNo