Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333991413
StrainMycobacterium_sp_JDM601
Protein IDYP_004524027.1
Description FEIII-dicitrate-binding periplasmic lipoprotein FecB [Mycobacterium
Sequence MMRADRRAAAAALAMLLVAASGCAGKSAETAPTSTTTTMVAGAGVLGNDR
RPDESCAPEPARADPGPAMRSVHNAPGVEPPGVEVPEEPERIVVLSGDQL
DALCALGLQSRVVGAALPDDSENQPSYLGAVMHGLPAVGSRSTPDIDAIA
ALHPDLILGAQGLTPGYSELASIAPTVFTGAPGAAWEDNLRGVGAATARS
GATDVVLDKFGRAAAETGEAADATHFQASVVALTDAGVRVYGAANFAASV
LKAVGVDRPPSQRFTDQPYVEIAASDADLAGRADLSAADGDIVYVSFAST
AAKARAAAVFDSVSWRRLAANRDSRVFVVNNEVWQTGQGPIAALGVVDDL
RWLNAPIN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo