Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333991427
StrainMycobacterium_sp_JDM601
Protein IDYP_004524041.1
Description ribonucleoside-diphosphate reductase NrdE [Mycobacterium sp. JDM601
Sequence MGELDFHALNAMLNLYDSDGKIQFDKDVLAARQYFLEHVNQNTVFFHNQD
EKLDYLIQKDYYEREVLDQYSRNFVKSLLDRAYAKKFRFPTFLGAFKYYT
SYTLKTFDGKRYLERFEDRVCMVALTLAAGDTKLAEQLVDEIIDGRFQPA
TPTFLNSGKKQRGEAVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALL
LTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLH
AHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFS
PYDVERVYGVPFADISVSEKYYEMVDNSAIRKTKIKAREFFQTVAELQFE
SGYPYVMFEDTVNRANPIAGKITHSNLCSEILQVSTPSEYNDDLSYAKVG
KDISCNLGSLNIAKAMDSPDFGQTIEVAIRALTAVSDQTHINSVPSIEHG
NNESHAIGLGQMNLHGYLARESIHYGSEEGIDFTNIYFYTVLYHALRASN
RLALERGRSFVGFEKSKYASGEFFDKYINQVWEPKTVRVRQLFADAGIRI
PEQSDWQRLKESVAAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKIE
IRKEGKIGRVYYPAPYMTNDNLEYYSDAYEIGYEKIIDTYAAATQHVDQG
LSLTLFFKDTATTRDVNRAQIYAWRKGIKTLYYIRLRQMALEGTEVEGCV
SCML
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)2
Vaccine TargetNo