Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333991625
StrainMycobacterium_sp_JDM601
Protein IDYP_004524239.1
Description two-component sensory transduction histidine kinase MtrB [Mycobacte
Sequence MIFSSRRRPRRSGPLLLGVNTLRRAVQIAWRRSLQLRVVVLTMGLSAAVI
LALGFVLTSQITDRVLDVKVRAATEQIERARITAGGIVGGEEARSLTSSL
QLARNTLMSKTDPASGSGTAGAFDAVLVVLGEGPRAATSAGPVDQVPAAL
REFVKAGQVSYQYATVHVEGFSGPALVIGTPTTSRITNLELYLIYPLGSE
RNTISMVRGTIATGGLVLLVLLAGIALLVSRQVVLPVRSASRIAERFAEG
HLSERMPVRGEDDMARLAVSFNDMAESLSRQITQLEEFGNLQRRFTSDVS
HELRTPLTTVRMAADLIHDHSEDLEPSLRRSTELLVSELDRFESLLNDLL
EISRHDAGVAELSVESVDLRSTVNSALDNVGHLAAEAGVELRVNVPGDPV
IAEVDPRRVERILRNLIANAIDHAEHKPVVIRMGADADTVAVTVRDHGVG
LRPGEEKLVFSRFWRADPSRVRRSGGTGLGLAISVEDARLHQGRLEAWGE
PGKGACFRLTLPLVRGHKVTTSPLPMKPVSAAERRERRQRAREHAERSG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo